CIZ1 purified MaxPab mouse polyclonal antibody (B01P)
  • CIZ1 purified MaxPab mouse polyclonal antibody (B01P)

CIZ1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00025792-B01P
CIZ1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CIZ1 protein.
Información adicional
Size 50 ug
Gene Name CIZ1
Gene Alias LSFR1|NP94|ZNF356
Gene Description CDKN1A interacting zinc finger protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MFSQQQQQQLQQQQQQLQQLQQQQLQQQQLQQQQLLQLQQLLQQSPPQAPLPMAVSRGLPPQQPQQPLLNLQGTNSASLLNGSMLQRALLLQQLQGNLRGYGMASPGLAAPSLTPPQLATPNLQQFFPQATRQSLLGPPPVGVPMNPSQFNLSGRNPQKQARTSSSTTPNRKDSSSQTMPVEDKSDPPEGSEEAAEPRMDTPEDQDLPPCPEDIAKEKRTPAPEPEPCEASELPAKRLRSSEEPTEKEPPGQLQV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CIZ1 (AAH21163.1, 1 a.a. ~ 818 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25792

Enviar un mensaje


CIZ1 purified MaxPab mouse polyclonal antibody (B01P)

CIZ1 purified MaxPab mouse polyclonal antibody (B01P)