RAD54B purified MaxPab rabbit polyclonal antibody (D01P)
  • RAD54B purified MaxPab rabbit polyclonal antibody (D01P)

RAD54B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00025788-D01P
RAD54B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RAD54B protein.
Información adicional
Size 100 ug
Gene Name RAD54B
Gene Alias FSBP|RDH54
Gene Description RAD54 homolog B (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQREEHELVHVMERSLSPSLSSVDMRMTSSPSSIPRRDDFFRHESGEHFRSLLGYDPQILQMLKEEHQIILENQKNFGLYVQEKRDGLKRRQQLEEELLRAKIEVEKLKAIRLRHDLPEYNSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAD54B (AAH33710.2, 1 a.a. ~ 158 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25788

Enviar un mensaje


RAD54B purified MaxPab rabbit polyclonal antibody (D01P)

RAD54B purified MaxPab rabbit polyclonal antibody (D01P)