RASGRP3 monoclonal antibody (M02), clone 1H4
  • RASGRP3 monoclonal antibody (M02), clone 1H4

RASGRP3 monoclonal antibody (M02), clone 1H4

Ref: AB-H00025780-M02
RASGRP3 monoclonal antibody (M02), clone 1H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RASGRP3.
Información adicional
Size 100 ug
Gene Name RASGRP3
Gene Alias GRP3|KIAA0846
Gene Description RAS guanyl releasing protein 3 (calcium and DAG-regulated)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYRNATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RASGRP3 (NP_733772.1, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 25780
Clone Number 1H4
Iso type IgG2a Kappa

Enviar un mensaje


RASGRP3 monoclonal antibody (M02), clone 1H4

RASGRP3 monoclonal antibody (M02), clone 1H4