RASGRP3 polyclonal antibody (A01)
  • RASGRP3 polyclonal antibody (A01)

RASGRP3 polyclonal antibody (A01)

Ref: AB-H00025780-A01
RASGRP3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RASGRP3.
Información adicional
Size 50 uL
Gene Name RASGRP3
Gene Alias GRP3|KIAA0846
Gene Description RAS guanyl releasing protein 3 (calcium and DAG-regulated)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq AGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RASGRP3 (AAH27849, 581 a.a. ~ 690 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 25780

Enviar un mensaje


RASGRP3 polyclonal antibody (A01)

RASGRP3 polyclonal antibody (A01)