CLDN15 purified MaxPab rabbit polyclonal antibody (D01P)
  • CLDN15 purified MaxPab rabbit polyclonal antibody (D01P)

CLDN15 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00024146-D01P
CLDN15 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CLDN15 protein.
Información adicional
Size 100 ug
Gene Name CLDN15
Gene Alias FLJ42715|MGC19536
Gene Description claudin 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVYNCWEFPSMLALSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATAGALHILAGICGMVAISWYAFNITRDFFDPLYPGTKYELGPALYLGWSASLISILGGLCLCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CLDN15 (NP_055158.1, 1 a.a. ~ 228 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 24146

Enviar un mensaje


CLDN15 purified MaxPab rabbit polyclonal antibody (D01P)

CLDN15 purified MaxPab rabbit polyclonal antibody (D01P)