NAT6 purified MaxPab rabbit polyclonal antibody (D01P)
  • NAT6 purified MaxPab rabbit polyclonal antibody (D01P)

NAT6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00024142-D01P
NAT6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NAT6 protein.
Información adicional
Size 100 ug
Gene Name NAT6
Gene Alias FUS-2|FUS2
Gene Description N-acetyltransferase 6 (GCN5-related)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MQELTLSPGPAKLTPTLDPTHRMELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTLDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NAT6 (NP_036323.2, 1 a.a. ~ 308 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 24142

Enviar un mensaje


NAT6 purified MaxPab rabbit polyclonal antibody (D01P)

NAT6 purified MaxPab rabbit polyclonal antibody (D01P)