Ver mas grande
NAT6 purified MaxPab rabbit polyclonal antibody (D01P)
AB-H00024142-D01P
Producto nuevo
NAT6 purified MaxPab rabbit polyclonal antibody (D01P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | NAT6 |
| Gene Alias | FUS-2|FUS2 |
| Gene Description | N-acetyltransferase 6 (GCN5-related) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Ce,WB-Tr |
| Immunogen Prot. Seq | MQELTLSPGPAKLTPTLDPTHRMELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTLDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAP |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | NAT6 (NP_036323.2, 1 a.a. ~ 308 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 24142 |
Más información
Rabbit polyclonal antibody raised against a full-length human NAT6 protein.