PITPNB polyclonal antibody (A01)
  • PITPNB polyclonal antibody (A01)

PITPNB polyclonal antibody (A01)

Ref: AB-H00023760-A01
PITPNB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PITPNB.
Información adicional
Size 50 uL
Gene Name PITPNB
Gene Alias PI-TP-beta|PtdInsTP|VIB1B
Gene Description phosphatidylinositol transfer protein, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PITPNB (NP_036531, 181 a.a. ~ 271 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23760

Enviar un mensaje


PITPNB polyclonal antibody (A01)

PITPNB polyclonal antibody (A01)