PPIL2 monoclonal antibody (M04), clone 2A10
  • PPIL2 monoclonal antibody (M04), clone 2A10

PPIL2 monoclonal antibody (M04), clone 2A10

Ref: AB-H00023759-M04
PPIL2 monoclonal antibody (M04), clone 2A10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PPIL2.
Información adicional
Size 100 ug
Gene Name PPIL2
Gene Alias CYC4|CYP60|Cyp-60|FLJ39930|MGC33174|MGC787|hCyP-60
Gene Description peptidylprolyl isomerase (cyclophilin)-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MGKRQHQKDKMYITCAEYTHFYGGKKPDLPQTNFRRLPFDHCSLSLQPFVYPVCTPDGIVFDLLNIVPWLKKYGTNPSNGEKLDGRSLIKLNFSKNSEGKYHCPVLFTVFTNNTHIVAVRTTGNVYAYEAVEQLNIKAKNFRDLLTDEPFSRQDIITLQDPTNLDKFNVSNFYHVKNNMKIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAPEKKKVDKLNAAHYSTGKVSASFTSTAM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPIL2 (AAH00022, 1 a.a. ~ 527 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23759
Clone Number 2A10
Iso type IgG2b Kappa

Enviar un mensaje


PPIL2 monoclonal antibody (M04), clone 2A10

PPIL2 monoclonal antibody (M04), clone 2A10