BHMT2 polyclonal antibody (A01)
  • BHMT2 polyclonal antibody (A01)

BHMT2 polyclonal antibody (A01)

Ref: AB-H00023743-A01
BHMT2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BHMT2.
Información adicional
Size 50 uL
Gene Name BHMT2
Gene Alias FLJ20001
Gene Description betaine-homocysteine methyltransferase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAPAGRPGAKKGILERLESGEVVIGDGSFLITLEKRGYVKAGLWTPEAVIEHPDAVRQLHMEFLRAGSNVMQTFTFSASEDNMESKWEDVNAAACDLAREVAGKGDALVA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BHMT2 (NP_060084, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23743

Enviar un mensaje


BHMT2 polyclonal antibody (A01)

BHMT2 polyclonal antibody (A01)