CRI1 polyclonal antibody (A01)
  • CRI1 polyclonal antibody (A01)

CRI1 polyclonal antibody (A01)

Ref: AB-H00023741-A01
CRI1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CRI1.
Información adicional
Size 50 uL
Gene Name EID1
Gene Alias C15orf3|CRI1|EID-1|IRO45620|MGC138883|MGC138884|PNAS-22|PTD014|RBP21
Gene Description EP300 interacting inhibitor of differentiation 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRI1 (NP_055150, 116 a.a. ~ 187 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23741

Enviar un mensaje


CRI1 polyclonal antibody (A01)

CRI1 polyclonal antibody (A01)