SHPK purified MaxPab rabbit polyclonal antibody (D01P)
  • SHPK purified MaxPab rabbit polyclonal antibody (D01P)

SHPK purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023729-D01P
SHPK purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SHPK protein.
Información adicional
Size 100 ug
Gene Name SHPK
Gene Alias CARKL|FLJ32478|SHK
Gene Description sedoheptulokinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAARPITLGIDLGTTSVKAALLRAAPDDPSGFAVLASCARAARAEAAVESAVAGPQGREQDVSRILQALHECLAALPRPQLRSVVGIGVSGQMHGVVFWKTGQGCEWTEGGITPVFEPRAVSHLVTWQDGRCSSEFLASLPQPKSHLSVATGFGCATIFWLLKYRPEFLKSYDAAGTIHDYVVAMLCGLPRPLMSDQNAASWGYFNTQSQSWNVETLRSSGFPVHLLPDIAEPGSVAGRTSHMWFEIPKGTQVGV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SHPK (NP_037408.2, 1 a.a. ~ 478 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23729

Enviar un mensaje


SHPK purified MaxPab rabbit polyclonal antibody (D01P)

SHPK purified MaxPab rabbit polyclonal antibody (D01P)