CADM1 polyclonal antibody (A01)
  • CADM1 polyclonal antibody (A01)

CADM1 polyclonal antibody (A01)

Ref: AB-H00023705-A01
CADM1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CADM1.
Información adicional
Size 50 uL
Gene Name CADM1
Gene Alias BL2|DKFZp686F1789|IGSF4|IGSF4A|MGC149785|MGC51880|NECL2|Necl-2|RA175|ST17|SYNCAM|TSLC1|sTSLC-1|sgIGSF|synCAM1
Gene Description cell adhesion molecule 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq IQRDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CADM1 (NP_055148, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23705

Enviar un mensaje


CADM1 polyclonal antibody (A01)

CADM1 polyclonal antibody (A01)