RAB38 monoclonal antibody (M02), clone 7F1
  • RAB38 monoclonal antibody (M02), clone 7F1

RAB38 monoclonal antibody (M02), clone 7F1

Ref: AB-H00023682-M02
RAB38 monoclonal antibody (M02), clone 7F1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAB38.
Información adicional
Size 100 ug
Gene Name RAB38
Gene Alias NY-MEL-1|rrGTPbp
Gene Description RAB38, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB38 (NP_071732, 115 a.a. ~ 211 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23682
Clone Number 7F1
Iso type IgG2b Kappa

Enviar un mensaje


RAB38 monoclonal antibody (M02), clone 7F1

RAB38 monoclonal antibody (M02), clone 7F1