RAB38 polyclonal antibody (A01)
  • RAB38 polyclonal antibody (A01)

RAB38 polyclonal antibody (A01)

Ref: AB-H00023682-A01
RAB38 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RAB38.
Información adicional
Size 50 uL
Gene Name RAB38
Gene Alias NY-MEL-1|rrGTPbp
Gene Description RAB38, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB38 (NP_071732, 115 a.a. ~ 211 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23682

Enviar un mensaje


RAB38 polyclonal antibody (A01)

RAB38 polyclonal antibody (A01)