SGKL monoclonal antibody (M02), clone 2A7
  • SGKL monoclonal antibody (M02), clone 2A7

SGKL monoclonal antibody (M02), clone 2A7

Ref: AB-H00023678-M02
SGKL monoclonal antibody (M02), clone 2A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SGKL.
Información adicional
Size 100 ug
Gene Name SGK3
Gene Alias CISK|DKFZp781N0293|SGK2|SGKL
Gene Description serum/glucocorticoid regulated kinase family, member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SGKL (AAH15326, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23678
Clone Number 2A7
Iso type IgG2b Kappa

Enviar un mensaje


SGKL monoclonal antibody (M02), clone 2A7

SGKL monoclonal antibody (M02), clone 2A7