SH3BP4 monoclonal antibody (M11), clone 2B6
  • SH3BP4 monoclonal antibody (M11), clone 2B6

SH3BP4 monoclonal antibody (M11), clone 2B6

Ref: AB-H00023677-M11
SH3BP4 monoclonal antibody (M11), clone 2B6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SH3BP4.
Información adicional
Size 100 ug
Gene Name SH3BP4
Gene Alias BOG25|TTP
Gene Description SH3-domain binding protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAAQRIRAANSNGLPRCKSEGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SH3BP4 (AAH57396, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23677
Clone Number 2B6
Iso type IgG2b Kappa

Enviar un mensaje


SH3BP4 monoclonal antibody (M11), clone 2B6

SH3BP4 monoclonal antibody (M11), clone 2B6