TRIM29 purified MaxPab mouse polyclonal antibody (B01P)
  • TRIM29 purified MaxPab mouse polyclonal antibody (B01P)

TRIM29 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023650-B01P
TRIM29 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRIM29 protein.
Información adicional
Size 50 ug
Gene Name TRIM29
Gene Alias ATDC|FLJ36085
Gene Description tripartite motif-containing 29
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MEAADASRSNGSSPEARDARSPSGPSGSLENGTKADGKDAKTTNGHGGEAAEGKSLGSALKPGEGRSALFAGNEWRRPIIQFVESGDDKNSNYFSMDSMEGKRSPYAGLQLGAAKKPPVTFAEKGELRKSIFSESRKPTVSIMEPGETRRNSYPRADTGLFSRSKSGSEEVLCDSCIGNKQKAVKSCLVCQASFCELHLKPHLEGAAFRDHQLLEPIRDFEARKCPVHGKTMELFCQTDQTCICYLCMFQEHKNH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRIM29 (NP_036233.2, 1 a.a. ~ 588 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23650

Enviar un mensaje


TRIM29 purified MaxPab mouse polyclonal antibody (B01P)

TRIM29 purified MaxPab mouse polyclonal antibody (B01P)