LY96 purified MaxPab rabbit polyclonal antibody (D01P)
  • LY96 purified MaxPab rabbit polyclonal antibody (D01P)

LY96 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023643-D01P
LY96 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human LY96 protein.
Información adicional
Size 100 ug
Gene Name LY96
Gene Alias MD-2|MD2
Gene Description lymphocyte antigen 96
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MLPFLFFSTLFSSIFTEAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LY96 (NP_056179.1, 1 a.a. ~ 160 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23643

Enviar un mensaje


LY96 purified MaxPab rabbit polyclonal antibody (D01P)

LY96 purified MaxPab rabbit polyclonal antibody (D01P)