LDOC1 monoclonal antibody (M13), clone 3E5
  • LDOC1 monoclonal antibody (M13), clone 3E5

LDOC1 monoclonal antibody (M13), clone 3E5

Ref: AB-H00023641-M13
LDOC1 monoclonal antibody (M13), clone 3E5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant LDOC1.
Información adicional
Size 100 ug
Gene Name LDOC1
Gene Alias BCUR1|Mar7|Mart7
Gene Description leucine zipper, down-regulated in cancer 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDEEEEDDY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LDOC1 (NP_036449.1, 1 a.a. ~ 146 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23641
Clone Number 3E5
Iso type IgG2a Kappa

Enviar un mensaje


LDOC1 monoclonal antibody (M13), clone 3E5

LDOC1 monoclonal antibody (M13), clone 3E5