RABGAP1 MaxPab rabbit polyclonal antibody (D01)
  • RABGAP1 MaxPab rabbit polyclonal antibody (D01)

RABGAP1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00023637-D01
RABGAP1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RABGAP1 protein.
Información adicional
Size 100 uL
Gene Name RABGAP1
Gene Alias DKFZp586D2123|GAPCENA|RP11-123N4.2|TBC1D11
Gene Description RAB GTPase activating protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MDDQPGEKELVKRSQLDGEGDGPLSNQLSASSTINPVPLVGLQKPEMSLPVKPGQGDSEASSPFTPVADEDSVVFSKLTYLGCASVNAPRSEVEALRMMSILRSQCQISLDVTLSVPNVSEGIVRLLDPQTNTEIANYPIYKILFCVRGHDGTPESDCFAFTESHYNAELFRIHVFRCEIQEAVSRILYSFATAFRRSAKQTPLSATAAPQTPDSDIFTFSVSLEIKEDDGKGYFSAVPKDKDRQCFKLRQGIDK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RABGAP1 (NP_036329.2, 1 a.a. ~ 997 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 23637

Enviar un mensaje


RABGAP1 MaxPab rabbit polyclonal antibody (D01)

RABGAP1 MaxPab rabbit polyclonal antibody (D01)