SSBP2 purified MaxPab mouse polyclonal antibody (B02P)
  • SSBP2 purified MaxPab mouse polyclonal antibody (B02P)

SSBP2 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00023635-B02P
SSBP2 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SSBP2 protein.
Información adicional
Size 50 ug
Gene Name SSBP2
Gene Alias DKFZp686F03273|HSPC116
Gene Description single-stranded DNA binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDYSAAAAPSPVLGNIPPGDGMPVGPVPPGFFQPFMSPRYPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTPPRGMVPLGPQNYGGAMRPPLNALGGPGMPGMNMGPGGGRPWPNPTNANSIPYSSASPGNYVGPPGGGGPPGTPIM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SSBP2 (NP_036578.2, 1 a.a. ~ 361 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23635

Enviar un mensaje


SSBP2 purified MaxPab mouse polyclonal antibody (B02P)

SSBP2 purified MaxPab mouse polyclonal antibody (B02P)