BACE1 purified MaxPab rabbit polyclonal antibody (D01P)
  • BACE1 purified MaxPab rabbit polyclonal antibody (D01P)

BACE1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023621-D01P
BACE1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human BACE1 protein.
Información adicional
Size 100 ug
Gene Name BACE1
Gene Alias ASP2|BACE|FLJ90568|HSPC104|KIAA1149
Gene Description beta-site APP-cleaving enzyme 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BACE1 (NP_620428.1, 1 a.a. ~ 476 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23621

Enviar un mensaje


BACE1 purified MaxPab rabbit polyclonal antibody (D01P)

BACE1 purified MaxPab rabbit polyclonal antibody (D01P)