Ver mas grande
TSSK2 monoclonal antibody (M01), clone 1E12
AB-H00023617-M01
Producto nuevo
TSSK2 monoclonal antibody (M01), clone 1E12
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | TSSK2 |
| Gene Alias | DGS-G|FLJ38613|SPOGA2|STK22B |
| Gene Description | testis-specific serine kinase 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr,WB-Re,ELISA |
| Immunogen Prot. Seq | MDDATVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPREMDILATVNHGSIIKTYEIFETSDGRIYIIMELGVQGDLLEFIKCQGALHEDVARKMFRQLSSAVKYCHDLDIVHRDLKCENLLLDKDFNIKLSDFGFSKRCLRDSNGRIILSKTFCGSAAYAAPEVLQSIPYQPKVYDIWSLGVILYIMVCGSMPYDDSDIRKMLRIQKEHRVDFPRSKNLTCECKDLIYRMLQP |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | TSSK2 (AAH37781, 1 a.a. ~ 358 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 23617 |
| Clone Number | 1E12 |
| Iso type | IgG2a kappa |
Más información
Mouse monoclonal antibody raised against a full length recombinant TSSK2.