Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ZMYND8 monoclonal antibody (M06), clone 6A12
Abnova
ZMYND8 monoclonal antibody (M06), clone 6A12
Ref: AB-H00023613-M06
ZMYND8 monoclonal antibody (M06), clone 6A12
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ZMYND8.
Información adicional
Size
100 ug
Gene Name
ZMYND8
Gene Alias
MGC31836|PRKCBP1|PRO2893|RACK7
Gene Description
zinc finger, MYND-type containing 8
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq
DEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHL
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ZMYND8 (NP_898869, 601 a.a. ~ 698 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
23613
Clone Number
6A12
Iso type
IgG1 Kappa
Enviar un mensaje
ZMYND8 monoclonal antibody (M06), clone 6A12
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*