MKRN2 purified MaxPab mouse polyclonal antibody (B01P)
  • MKRN2 purified MaxPab mouse polyclonal antibody (B01P)

MKRN2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023609-B01P
MKRN2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MKRN2 protein.
Información adicional
Size 50 ug
Gene Name MKRN2
Gene Alias HSPC070|RNF62
Gene Description makorin ring finger protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSTKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCRYDHTRPSAAAGGAVGTMAHSVPSPAFHSPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQLCPYAAAGECRFGDACVYLHGEVCEICRLQVLHPFDPEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSICMEVILEKASASERR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MKRN2 (NP_054879.3, 1 a.a. ~ 416 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23609

Enviar un mensaje


MKRN2 purified MaxPab mouse polyclonal antibody (B01P)

MKRN2 purified MaxPab mouse polyclonal antibody (B01P)