MKRN1 monoclonal antibody (M01), clone 4E9
  • MKRN1 monoclonal antibody (M01), clone 4E9

MKRN1 monoclonal antibody (M01), clone 4E9

Ref: AB-H00023608-M01
MKRN1 monoclonal antibody (M01), clone 4E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MKRN1.
Información adicional
Size 100 ug
Gene Name MKRN1
Gene Alias FLJ21334|RNF61
Gene Description makorin ring finger protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFWELIEERENSNPFDNDEEEVV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MKRN1 (NP_038474, 365 a.a. ~ 440 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23608
Clone Number 4E9
Iso type IgG2b Kappa

Enviar un mensaje


MKRN1 monoclonal antibody (M01), clone 4E9

MKRN1 monoclonal antibody (M01), clone 4E9