Ver mas grande
CDC42EP4 monoclonal antibody (M05), clone 3G10
AB-H00023580-M05
Producto nuevo
CDC42EP4 monoclonal antibody (M05), clone 3G10
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | CDC42EP4 |
| Gene Alias | BORG4|CEP4|KAIA1777|MGC17125|MGC3740 |
| Gene Description | CDC42 effector protein (Rho GTPase binding) 4 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,ELISA |
| Immunogen Prot. Seq | VPRRNGAAGPHSPDPLLDEQAFGDLTDLPVVPKATYGLKHAESIMSFHIDLGPSMLGDVLSIM |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CDC42EP4 (NP_036253, 163 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 23580 |
| Clone Number | 3G10 |
| Iso type | IgG2b Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant CDC42EP4.