DDAH1 monoclonal antibody (M01), clone 3F7
  • DDAH1 monoclonal antibody (M01), clone 3F7

DDAH1 monoclonal antibody (M01), clone 3F7

Ref: AB-H00023576-M01
DDAH1 monoclonal antibody (M01), clone 3F7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DDAH1.
Información adicional
Size 100 ug
Gene Name DDAH1
Gene Alias DDAH|FLJ21264|FLJ25539
Gene Description dimethylarginine dimethylaminohydrolase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDAH1 (NP_036269.1, 181 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23576
Clone Number 3F7
Iso type IgG2a Kappa

Enviar un mensaje


DDAH1 monoclonal antibody (M01), clone 3F7

DDAH1 monoclonal antibody (M01), clone 3F7