CLDN14 polyclonal antibody (A01)
  • CLDN14 polyclonal antibody (A01)

CLDN14 polyclonal antibody (A01)

Ref: AB-H00023562-A01
CLDN14 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CLDN14.
Información adicional
Size 50 uL
Gene Name CLDN14
Gene Alias DFNB29
Gene Description claudin 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPQDLQAAR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLDN14 (NP_036262, 29 a.a. ~ 81 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23562

Enviar un mensaje


CLDN14 polyclonal antibody (A01)

CLDN14 polyclonal antibody (A01)