SNAPIN purified MaxPab mouse polyclonal antibody (B01P)
  • SNAPIN purified MaxPab mouse polyclonal antibody (B01P)

SNAPIN purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023557-B01P
SNAPIN purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SNAPIN protein.
Información adicional
Size 50 ug
Gene Name SNAPIN
Gene Alias SNAPAP
Gene Description SNAP-associated protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SNAPIN (AAH04494, 1 a.a. ~ 136 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23557

Enviar un mensaje


SNAPIN purified MaxPab mouse polyclonal antibody (B01P)

SNAPIN purified MaxPab mouse polyclonal antibody (B01P)