CCRK MaxPab rabbit polyclonal antibody (D01)
  • CCRK MaxPab rabbit polyclonal antibody (D01)

CCRK MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00023552-D01
CCRK MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CCRK protein.
Información adicional
Size 100 uL
Gene Name CCRK
Gene Alias CDCH|p42
Gene Description cell cycle related kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCRK (AAH02655.1, 1 a.a. ~ 275 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 23552

Enviar un mensaje


CCRK MaxPab rabbit polyclonal antibody (D01)

CCRK MaxPab rabbit polyclonal antibody (D01)