RASD2 purified MaxPab mouse polyclonal antibody (B01P)
  • RASD2 purified MaxPab mouse polyclonal antibody (B01P)

RASD2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023551-B01P
RASD2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RASD2 protein.
Información adicional
Size 50 ug
Gene Name RASD2
Gene Alias MGC:4834|Rhes|TEM2
Gene Description RASD family, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RASD2 (NP_055125.2, 1 a.a. ~ 266 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23551

Enviar un mensaje


RASD2 purified MaxPab mouse polyclonal antibody (B01P)

RASD2 purified MaxPab mouse polyclonal antibody (B01P)