DNPEP purified MaxPab rabbit polyclonal antibody (D01P)
  • DNPEP purified MaxPab rabbit polyclonal antibody (D01P)

DNPEP purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023549-D01P
DNPEP purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DNPEP protein.
Información adicional
Size 100 ug
Gene Name DNPEP
Gene Alias ASPEP|DAP
Gene Description aspartyl aminopeptidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTRNSSTIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRVIVKCPTSGRLEQQLVHVERPILRIPHLAIHLQRNINENFGPNTEMHLVPILATAIQEELEKGTPEPGLSMLWMSGTIRSSCPCSVPIWG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DNPEP (AAH03040.1, 1 a.a. ~ 164 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23549

Enviar un mensaje


DNPEP purified MaxPab rabbit polyclonal antibody (D01P)

DNPEP purified MaxPab rabbit polyclonal antibody (D01P)