RBM9 monoclonal antibody (M01), clone 4G3
  • RBM9 monoclonal antibody (M01), clone 4G3

RBM9 monoclonal antibody (M01), clone 4G3

Ref: AB-H00023543-M01
RBM9 monoclonal antibody (M01), clone 4G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RBM9.
Información adicional
Size 100 ug
Gene Name RBM9
Gene Alias FOX2|Fox-2|HNRBP2|HRNBP2|RTA|dJ106I20.3|fxh
Gene Description RNA binding motif protein 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBM9 (AAH13115, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23543
Clone Number 4G3
Iso type IgG2a Kappa

Enviar un mensaje


RBM9 monoclonal antibody (M01), clone 4G3

RBM9 monoclonal antibody (M01), clone 4G3