PIK3R5 purified MaxPab rabbit polyclonal antibody (D01P)
  • PIK3R5 purified MaxPab rabbit polyclonal antibody (D01P)

PIK3R5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023533-D01P
PIK3R5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PIK3R5 protein.
Información adicional
Size 100 ug
Gene Name PIK3R5
Gene Alias F730038I15Rik|FOAP-2|P101-PI3K|p101
Gene Description phosphoinositide-3-kinase, regulatory subunit 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MDSGYVEDSEESSSEWPWRRGSQERRGHRRPGQKFIRIYKLFKSTSQLVLRRDSRSLEGSSDTALPLRRAGSLCSPLDEPVSPPSRAQRSRSLPQPKLGTQLPSWLLAPASRPQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSNLRRLENNRPLLTRFFKLQFFYVPVKRSHGTSPGACPPPRSQTPSPPTDSPRHASPGELGTTPWEESTNDISHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKAE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PIK3R5 (AAH28212.1, 1 a.a. ~ 494 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23533

Enviar un mensaje


PIK3R5 purified MaxPab rabbit polyclonal antibody (D01P)

PIK3R5 purified MaxPab rabbit polyclonal antibody (D01P)