HMHA1 monoclonal antibody (M06), clone 4H7
  • HMHA1 monoclonal antibody (M06), clone 4H7

HMHA1 monoclonal antibody (M06), clone 4H7

Ref: AB-H00023526-M06
HMHA1 monoclonal antibody (M06), clone 4H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HMHA1.
Información adicional
Size 100 ug
Gene Name HMHA1
Gene Alias HA-1|HLA-HA1|KIAA0223
Gene Description histocompatibility (minor) HA-1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq HRSPLTAASPGELPTEGAGPDVVEDISHLLADVARFAEGLEKLKECVLHDDLLEARRPRAHECLGEALRVMHQIISKYPLLNTVETLTAAGTLIAKVKAF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HMHA1 (AAH65223.1, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23526
Clone Number 4H7
Iso type IgG2a Kappa

Enviar un mensaje


HMHA1 monoclonal antibody (M06), clone 4H7

HMHA1 monoclonal antibody (M06), clone 4H7