MYST4 polyclonal antibody (A01)
  • MYST4 polyclonal antibody (A01)

MYST4 polyclonal antibody (A01)

Ref: AB-H00023522-A01
MYST4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MYST4.
Información adicional
Size 50 uL
Gene Name MYST4
Gene Alias DKFZp313G1618|FLJ90335|KAT6B|KIAA0383|MORF|MOZ2|qkf|querkopf
Gene Description MYST histone acetyltransferase (monocytic leukemia) 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FSSVKPGTFPKSAKGSRGSCNDLRNVDWNKLLRRAIEGLEEPNGSSLKNIEKYLRSQSDLTSTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYST4 (NP_036462, 80 a.a. ~ 172 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23522

Enviar un mensaje


MYST4 polyclonal antibody (A01)

MYST4 polyclonal antibody (A01)