POFUT1 monoclonal antibody (M01), clone 3H1
  • POFUT1 monoclonal antibody (M01), clone 3H1

POFUT1 monoclonal antibody (M01), clone 3H1

Ref: AB-H00023509-M01
POFUT1 monoclonal antibody (M01), clone 3H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant POFUT1.
Información adicional
Size 100 ug
Gene Name POFUT1
Gene Alias FUT12|KIAA0180|MGC2482|O-FUT|O-Fuc-T|O-FucT-1
Gene Description protein O-fucosyltransferase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRRENHSCVTLLFPR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POFUT1 (NP_758436, 85 a.a. ~ 194 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23509
Clone Number 3H1
Iso type IgG2a Kappa

Enviar un mensaje


POFUT1 monoclonal antibody (M01), clone 3H1

POFUT1 monoclonal antibody (M01), clone 3H1