DAAM2 purified MaxPab rabbit polyclonal antibody (D01P)
  • DAAM2 purified MaxPab rabbit polyclonal antibody (D01P)

DAAM2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023500-D01P
DAAM2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DAAM2 protein.
Información adicional
Size 100 ug
Gene Name DAAM2
Gene Alias KIAA0381|MGC90515|dJ90A20A.1
Gene Description dishevelled associated activator of morphogenesis 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDELDLTDKNREAMFALPPEKKWQIYCSKKKVPSLTPLATSQGSWHGVALAALACSCIHLMFITCQPCSRCWRNNSE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DAAM2 (AAH47575.1, 1 a.a. ~ 132 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23500

Enviar un mensaje


DAAM2 purified MaxPab rabbit polyclonal antibody (D01P)

DAAM2 purified MaxPab rabbit polyclonal antibody (D01P)