NIFUN monoclonal antibody (M02), clone 3D12-1D10
  • NIFUN monoclonal antibody (M02), clone 3D12-1D10

NIFUN monoclonal antibody (M02), clone 3D12-1D10

Ref: AB-H00023479-M02
NIFUN monoclonal antibody (M02), clone 3D12-1D10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant NIFUN.
Información adicional
Size 100 ug
Gene Name ISCU
Gene Alias 2310020H20Rik|HML|ISU2|MGC74517|NIFU|NIFUN|hnifU
Gene Description iron-sulfur cluster scaffold homolog (E. coli)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq RELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NIFUN (AAH11906, 26 a.a. ~ 167 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23479
Clone Number 3D12-1D10
Iso type IgG1 Kappa

Enviar un mensaje


NIFUN monoclonal antibody (M02), clone 3D12-1D10

NIFUN monoclonal antibody (M02), clone 3D12-1D10