CAPN7 purified MaxPab rabbit polyclonal antibody (D01P)
  • CAPN7 purified MaxPab rabbit polyclonal antibody (D01P)

CAPN7 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023473-D01P
CAPN7 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CAPN7 protein.
Información adicional
Size 100 ug
Gene Name CAPN7
Gene Alias CALPAIN7|FLJ36423|PALBH
Gene Description calpain 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDATALERDAVQFARLAVQRDHEGRYSEAVFYYKEAAQALIYAEMAGSSLENIQEKITEYLERVQALHSAVQSKSADPLKSKHQLDLERAHFLVTQAFDEDEKENVEDAIELYTEAVDLCLKTSYETADKVLQNKLKQLARQALDRAEALSEPLTKPVGKISSTSVKPKPPPVRAHFPLGANPFLERPQSFISPQSCDAQGQRYTAEEIEVLRTTSKINGIEYVPFMNVDLRERFAYPMPFCDRWGKLPLSPKQK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CAPN7 (NP_055111.1, 1 a.a. ~ 813 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23473

Enviar un mensaje


CAPN7 purified MaxPab rabbit polyclonal antibody (D01P)

CAPN7 purified MaxPab rabbit polyclonal antibody (D01P)