HEY1 purified MaxPab mouse polyclonal antibody (B02P)
  • HEY1 purified MaxPab mouse polyclonal antibody (B02P)

HEY1 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00023462-B02P
HEY1 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HEY1 protein.
Información adicional
Size 50 ug
Gene Name HEY1
Gene Alias BHLHb31|CHF2|HERP2|HESR1|HRT-1|MGC1274|OAF1
Gene Description hairy/enhancer-of-split related with YRPW motif 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HEY1 (NP_036390.3, 1 a.a. ~ 304 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23462

Enviar un mensaje


HEY1 purified MaxPab mouse polyclonal antibody (B02P)

HEY1 purified MaxPab mouse polyclonal antibody (B02P)