ABCA6 polyclonal antibody (A01)
  • ABCA6 polyclonal antibody (A01)

ABCA6 polyclonal antibody (A01)

Ref: AB-H00023460-A01
ABCA6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ABCA6.
Información adicional
Size 50 uL
Gene Name ABCA6
Gene Alias EST155051|FLJ43498
Gene Description ATP-binding cassette, sub-family A (ABC1), member 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq NVQFPGMAPQNLGRVDKFNSSSLMVVYTPISNLTQQIMNKTALAPLLKGTSVIGAPNKTHMDEILLENLPYAMGIIFNETFSYKLIFFQGYNSPLWK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ABCA6 (NP_525023, 53 a.a. ~ 149 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23460

Enviar un mensaje


ABCA6 polyclonal antibody (A01)

ABCA6 polyclonal antibody (A01)