ABCB9 polyclonal antibody (A01) Ver mas grande

ABCB9 polyclonal antibody (A01)

AB-H00023457-A01

Producto nuevo

ABCB9 polyclonal antibody (A01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 uL
Gene Name ABCB9
Gene Alias EST122234|KIAA1520|TAPL
Gene Description ATP-binding cassette, sub-family B (MDR/TAP), member 9
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq FIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISAYDHKYLHR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ABCB9 (NP_062571, 482 a.a. ~ 580 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23457

Más información

Mouse polyclonal antibody raised against a partial recombinant ABCB9.

Consulta sobre un producto

ABCB9 polyclonal antibody (A01)

ABCB9 polyclonal antibody (A01)