Ver mas grande
ABCB9 polyclonal antibody (A01)
AB-H00023457-A01
Producto nuevo
ABCB9 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | ABCB9 |
| Gene Alias | EST122234|KIAA1520|TAPL |
| Gene Description | ATP-binding cassette, sub-family B (MDR/TAP), member 9 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,ELISA |
| Immunogen Prot. Seq | FIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISAYDHKYLHR |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | ABCB9 (NP_062571, 482 a.a. ~ 580 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 23457 |
Más información
Mouse polyclonal antibody raised against a partial recombinant ABCB9.