SLC44A1 polyclonal antibody (A01)
  • SLC44A1 polyclonal antibody (A01)

SLC44A1 polyclonal antibody (A01)

Ref: AB-H00023446-A01
SLC44A1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SLC44A1.
Información adicional
Size 50 uL
Gene Name SLC44A1
Gene Alias CD92|CDW92|CHTL1|CTL1|RP11-287A8.1
Gene Description solute carrier family 44, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQELKTLSDVQKFAEINGSALCSYNLKPSEYTTSPKSSVLCPKLPVPASAPIPFFHRCAPVNISC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC44A1 (NP_536856, 74 a.a. ~ 183 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23446

Enviar un mensaje


SLC44A1 polyclonal antibody (A01)

SLC44A1 polyclonal antibody (A01)