SLC35A3 polyclonal antibody (A01)
  • SLC35A3 polyclonal antibody (A01)

SLC35A3 polyclonal antibody (A01)

Ref: AB-H00023443-A01
SLC35A3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SLC35A3.
Información adicional
Size 50 uL
Gene Name SLC35A3
Gene Alias DKFZp781P1297
Gene Description solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq DSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC35A3 (NP_036375, 61 a.a. ~ 113 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23443

Enviar un mensaje


SLC35A3 polyclonal antibody (A01)

SLC35A3 polyclonal antibody (A01)