TARDBP purified MaxPab rabbit polyclonal antibody (D01P)
  • TARDBP purified MaxPab rabbit polyclonal antibody (D01P)

TARDBP purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023435-D01P
TARDBP purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TARDBP protein.
Información adicional
Size 100 ug
Gene Name TARDBP
Gene Alias ALS10|TDP-43
Gene Description TAR DNA binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TARDBP (NP_031401.1, 1 a.a. ~ 414 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23435

Enviar un mensaje


TARDBP purified MaxPab rabbit polyclonal antibody (D01P)

TARDBP purified MaxPab rabbit polyclonal antibody (D01P)