TARDBP polyclonal antibody (A01)
  • TARDBP polyclonal antibody (A01)

TARDBP polyclonal antibody (A01)

Ref: AB-H00023435-A01
TARDBP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TARDBP.
Información adicional
Size 50 uL
Gene Name TARDBP
Gene Alias ALS10|TDP-43
Gene Description TAR DNA binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TARDBP (NP_031401.1, 1 a.a. ~ 260 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23435

Enviar un mensaje


TARDBP polyclonal antibody (A01)

TARDBP polyclonal antibody (A01)