GRIP1 polyclonal antibody (A01)
  • GRIP1 polyclonal antibody (A01)

GRIP1 polyclonal antibody (A01)

Ref: AB-H00023426-A01
GRIP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GRIP1.
Información adicional
Size 50 uL
Gene Name GRIP1
Gene Alias GRIP
Gene Description glutamate receptor interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QSGILRELEATIMSGSTMSLNHEAPTPRSQLGRQASFQERSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKEIMSPTPVELHKVTLYKDSDMEDFG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRIP1 (XP_290559, 851 a.a. ~ 950 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23426

Enviar un mensaje


GRIP1 polyclonal antibody (A01)

GRIP1 polyclonal antibody (A01)