CRB1 polyclonal antibody (A01)
  • CRB1 polyclonal antibody (A01)

CRB1 polyclonal antibody (A01)

Ref: AB-H00023418-A01
CRB1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CRB1.
Información adicional
Size 50 uL
Gene Name CRB1
Gene Alias LCA8|RP12
Gene Description crumbs homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FCNKNNTRCLSNSCQNNSTCKDFSKDNDCSCSDTANNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQHGGICHQDPIYPVC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRB1 (NP_036208, 26 a.a. ~ 134 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23418

Enviar un mensaje


CRB1 polyclonal antibody (A01)

CRB1 polyclonal antibody (A01)